Tutorial 11 - Protein structure prediction
Recap
Make sure you can answer the following questions:
Describe the levels of protein structure.
How do we represent and store them?
Explain the meaning of the words when used for genes: analog, homolog, paralog, ortholog and xenolog.
What is a protein ligand?
PDB file format from lammpstube.com. Further details: PDB file format.
Homology modeling - protein structure prediction exercise
A simple, although not always reliable, way to discover the secondary structure of a peptide sequence is to look up a protein with similar primary sequence in a database. Let us try this! The task is to obtain the secondary structure of the following peptide sequence: HYLCKYVINAIPPTLTAKIHFRPELPAERNQLIQRLA
Enter the sequence and enter “Homo sapiens (taxid:9606)” as organism.
Click the blast button and wait. This may take up to several minutes.
Look for the best matching protein. It should be: “monoamine oxidase A”
Enter this protein name to
UniProt.
Check whether the result has a secondary sequence annotation and find the position respective to the BLAST match.
Use the above-described procedure to learn most about the following peptide sequence: TEYAINKLRQLYVLRC.
Automated protein folding
ESMFold is a deep learning-based method developed for predicting protein tertiary structures from amino acid sequences. In the following steps, we will show how the method works. We will use one of the existing ESMFold predictions and verify it against PDB database.
Access the public ESMFold webserver
here.
Learn and download the sequence of 300 amino acids representing the primary sequence of PETase.
Predict/retrieve, visualize and download the ESMFold tertiary structure prediction (a PDB file).
Compare the predicted structure with the X-ray crystallography one available in the PDB database. Employ
Pairwise Structure Alignment available through the PDB site.
See the match (also shown in the right figure below).
Independent work
Predict and validate your own protein structure. The output to be reported:
a PDB protein of interest (you could start with the fragment from the homology section above),
a predicted structure,
a validation that reports the match between the experimental and predicted structure.
Test the limits of applicability of the prediction. You can focus on large proteins (such as dynein motor protein 4AKG with multiple interacting domains), disordered proteins, proteins with novel folds, or membrane proteins. However, it becomes more and more difficult to find proteins for which prediction fails. See for example the strengths and limitations of AlphaFold2.
Resources (other from the resources available above):
TM-align for protein structure alignment,
AlphaFold3 server for structure predictions containing proteins, DNA, RNA, ligands, ions (beware of a queuing system).
References
Abramson et al.: Accurate structure prediction of biomolecular interactions with AlphaFold 3, Nature, 2024 (pdf preprint).
Poleksic: Algorithms for optimal protein structure alignment, Bioinformatics, 2009 (online).