Make sure you can answer the following questions:
A simple, although not always reliable, way to discover the secondary structure of a peptide sequence is to look up a protein with similar primary sequence in a database. Let us try this! The task is to obtain the secondary structure of the following peptide sequence: HYLCKYVINAIPPTLTAKIHFRPELPAERNQLIQRLA
Use the above-described procedure to learn most about the following peptide sequence: TEYAINKLRQLYVLRC.
Recall the branch-and-bound threading algorithm from the lecture.
Suppose we have three segments (i, j, k), each of which includes three amino
acids. For a given sequence there are three possible starting positions for
each segment. (i ∈ {2,3,4}, j ∈ {8,9,10}, k ∈ {13,14,15})
We will be using the simple lower bound:
Suppose that you are given the following values for the scores of the individual segments and the scores for segment interactions:
| i | j | k |
|---|---|---|
| g1(i,2) = 5 | g1(j,8) = 9 | g1(k,13) = 3 |
| g1(i,3) = 2 | g1(j,9) = 7 | g1(k,14) = 4 |
| g1(i,4) = 8 | g1(j,10) = 6 | g1(k,15) = 1 |
| i/j | j/k | i/k |
|---|---|---|
| g2(i,j,2,8) = 1 | g2(j,k,8,13) = 7 | g2(i,k,2,13) = 1 |
| g2(i,j,2,9) = 2 | g2(j,k,8,14) = 8 | g2(i,k,2,14) = 2 |
| g2(i,j,2,10) = 2 | g2(j,k,8,15) = 7 | g2(i,k,2,15) = 5 |
| g2(i,j,3,8) = 5 | g2(j,k,9,13) = 1 | g2(i,k,3,13) = 5 |
| g2(i,j,3,9) = 6 | g2(j,k,9,14) = 6 | g2(i,k,3,14) = 6 |
| g2(i,j,3,10) = 4 | g2(j,k,9,15) = 8 | g2(i,k,3,15) = 4 |
| g2(i,j,4,8) = 7 | g2(j,k,10,13) = 11 | g2(i,k,4,13) = 1 |
| g2(i,j,4,9) = 3 | g2(j,k,10,14) = 12 | g2(i,k,4,14) = 2 |
| g2(i,j,4,10) = 4 | g2(j,k,10,15) = 13 | g2(i,k,4,15) = 4 |
Using this information, compute the optimal threading.
The purpose of this tutorial is to put our hands on a software for comparative protein structure modelling, namely the MODELLER. We will go through a basic tutorial for this software. At the end this tutorial, you should have a better understanding of what such software is capable of.
Download the MODELLER version for your operating system from: https://salilab.org/modeller/download_installation.html (Note: It is also available from official repositories of some GNU/Linux distributions.)
You need to register yourself in order to obtain a license here: https://salilab.org/modeller/registration.html You should provide your university e-mail in the registration form.
We will follow this tutorial from the MODELLER webpages: https://salilab.org/modeller/tutorial/basic.html.
For those who are interested to learn more about MODELLER, there are also advanced tutorials: https://salilab.org/modeller/tutorial/
If you are interested, you may also have a look at the I-TASSER software.
A tutorial on homology modelling from the university of Frankfurt.
Branch and bound threading example taken from https://www.biostat.wisc.edu/bmi776/spring-17/lectures/threading.pdf threading.pdf